- Accessories
 - Accommodation
 - Accounting
 - Airline
 - Amusement Park
 - Analytics
 - Appliances
 - Art
 - Auction site
 - Automotive
 - Bank
 - Beauty
 - Bike Rental
 - Biotechnology
 - Books
 - CRM
 - Call center software
 - Cameras
 - Cards
 - Chrome plugin
 - Cleaning Products
 - Clothing
 - Coffee
 - Collaboration
 - Community
 - Contact lenses
 - Coolers / Tumblers
 - Crowd funding
 - Cryptocurrency
 - Customer support
 - Dating
 - Department store
 - Design tools
 - Developer tools
 - Digital printing
 - Dining / Restaurant
 - Direct to consumer
 - Domain names
 - Drinkware
 - E-commerce
 - E-commerce store builder
 - Education
 - Electronic signatures
 - Electronics
 - Email Service Provider
 - Email marketing
 - Entertainment
 - Event management
 - Eyewear
 - Fashion
 - Finance
 - Fitness
 - Flight comparisons
 - Food & Beverage
 - Food delivery
 - Form builder
 - Fragrance
 - Freelancer tools
 - Furniture
 - Game
 - Gaming
 - Gifts
 - Glasses
 - Greetings cards
 - Groceries
 - Hair
 - Health
 - Hiring
 - Home & Garden
 - Hotel comparison
 - Hotels
 - Insurance
 - Investing
 - Jewelry
 - Kitchen
 - Landing page builder
 - Language learning
 - Linens
 - Lingerie
 - Live chat
 - Luggage / Cases
 - Makeup
 - Marijuana delivery
 - Marketing
 - Marketplace
 - Mattress company
 - Meal delivery kits
 - Media
 - Messaging
 - Museum
 - Music
 - Musical Instruments
 - NFT
 - News
 - No-code
 - Nonprofit
 - Nutrition
 - Online courses
 - Online-course-platform
 - Outdoor
 - Password manager
 - Payments
 - Performing Arts
 - Personal Finance
 - Pets
 - Pharmacy
 - Photography
 - Podcast Hosting
 - Podcasts
 - Productivity
 - Project management
 - Property
 - Proposal software
 - Publisher
 - Real estate
 - Reviews
 - Ride sharing
 - Running
 - SEO
 - SaaS
 - Sales tools
 - Scooters
 - Shoes
 - Skincare
 - Social network
 - Software
 - Sports
 - Sportsware
 - Subscription boxes
 - Sustainable Living
 - Swimwear
 - T-shirt Printing
 - Talent
 - Telco
 - Toys
 - Trains
 - Transport
 - Travel
 - Underwear
 - VPN
 - Video Maker
 - Video hosting
 - Video streaming
 - Voucher/Coupon Sites
 - Watches
 - Web hosting
 - Website builder
 - Workforce management
 - Writing
 
- & Other Stories
 - &Open
 - 1 Hotels
 - 1&1
 - 1Password
 - 3dcart
 - 6pm
 - A.C. Moore
 - ANNA by RadLabs
 - ASOS
 - AT&T
 - AVI-8
 - AYR
 - Abercrombie
 - Accessorize
 - Ace Hardware
 - ActiveCampaign
 - Acura
 - Acuvue
 - Adapt
 - Adidas
 - Agolde
 - Airbnb
 - Aircall
 - Airtable
 - Alaska Air
 - Aldi
 - All Saints
 - Allbirds
 - Almabase
 - Along
 - Aman Resorts
 - Amazon
 - Ambronite
 - American Airlines
 - American Apparel
 - American Civil Liberties Union
 - American Girl
 - American Red Cross
 - Anchor
 - Animoto
 - Ann Taylor
 - Anthropologie
 - Antidote Street
 - Apollo Theater
 - Apple
 - Architectural Digest
 - AriZona
 - Aritzia
 - Armani
 - Armani Exchange
 - Armogan
 - Asana
 - Asphalt Green
 - Astley Clarke
 - Athletic Brewing
 - Auberge Resorts
 - Audemars Piguet
 - Audi
 - Auverture
 - Away
 - BBC iPlayer
 - BECCA Cosmetics
 - BMW
 - Baby Brezza
 - Baremetrics
 - Barnes and Noble
 - Barton Perreira
 - Basecamp
 - Bath & Body Works
 - Beans
 - Bearbottom Clothing
 - Beaver Brooks
 - Beis
 - Ben Sherman
 - Bend
 - Bentley Motors
 - Bergdorf Goodman
 - Bespoke Post
 - Best Buy
 - Better Homes and Gardens
 - Big Blanket Co.
 - Big Brothers Big Sisters of America
 - Big Cartel
 - BigCommerce
 - Binance
 - Bing
 - Birch Lane
 - Birchbox
 - Birkenstock
 - Birthdate Co
 - BitClout
 - Bite
 - Black Opal Beauty
 - Blinkist
 - Blue Apron
 - Blue Bottle Coffee
 - Bluehost
 - Blueland
 - Bluemercury
 - Blundstone
 - Bobbi Brown
 - Bodily
 - Boisson
 - Bombas
 - Bon Appétit
 - Bonlook
 - Bonobos
 - Boohoo
 - Booking.com
 - Boots
 - Box
 - Bravissimo
 - Breaker
 - Breitling
 - Brez
 - Briggs & Riley
 - Brightedge
 - British Airways
 - Broadway Direct
 - Broadway NYC
 - Broadway in Hollywood
 - Brooklinen
 - Brooks
 - BrowserStack
 - BruMate
 - Bubble
 - Buffalo Wild Wings
 - Buffer
 - Burberry
 - Busch Gardens
 - Busuu
 - Bynder
 - CVS
 - Cadillac
 - CafePress
 - Calendly
 - Callaway Golf
 - Calm
 - Calpak
 - Candy Club
 - Candy Kittens
 - Canny
 - Canon
 - Canva
 - Carbonmade
 - Care
 - Careem
 - Carnegie Hall
 - Carnival Cruise Line
 - Carrd
 - Cars.com
 - Cartier
 - Cash App
 - Casper
 - Caviar
 - Cedar Point
 - Chalkbeat
 - Charity Water
 - ChartMogul
 - Chevrolet
 - Chewy
 - Chicago Children’s Museum
 - Chick-fil-A
 - Chico’s
 - Chilewich
 - Chococurb
 - Chubbies
 - Chuck and Don’s
 - Circle
 - Claire's
 - Clarks
 - ClassPass
 - ClickFunnels
 - ClickUp
 - Clinique
 - Clockify
 - Cloudflare
 - Clubhouse
 - Clue
 - Coach
 - Coastal
 - Coda
 - Codecademy
 - Coinbase
 - Common Sense
 - Conductor
 - Converse
 - ConvertKit
 - CopyAI
 - Costa del Mar
 - Costco
 - Coursera
 - Cover FX
 - Craft
 - Craigslist
 - Crate & Barrel
 - Crocs
 - Crypto.com
 - Cult Furniture
 - Curious Elixirs
 - Customer.io
 - DFS
 - Daisy Jewellery
 - Daniel Wellington
 - Datadog
 - De Soi
 - Debenhams
 - Deliveroo
 - Delivery.com
 - Delivra - The Inbox
 - Delsey Paris
 - Delta
 - Depop
 - Deputy
 - Descript
 - DesignByHümans
 - Designer Shoe Warehouse
 - Diadora
 - Dillards
 - Dior
 - Discord
 - Disney Cruise Line
 - Disney+
 - Djusie
 - Doctors Without Borders
 - DocuSign
 - Dolce & Gabbana
 - Dollar Shave Club
 - Dollywood
 - Domino's
 - DonorsChoose
 - DoorDash
 - Dorelan
 - Dorothy Perkins
 - Dr. Squatch
 - Drip
 - Dropbox
 - Dropbox Paper
 - Drops
 - Drury Hotels
 - Duda
 - Duolingo
 - Dwell
 - EasyJet
 - Eaze
 - Echo Water
 - Elevate
 - Elle
 - Ellucian
 - Entrepreneur
 - Envato
 - Environmental Defense Fund
 - Envoyage
 - Etsy
 - Eurostar
 - Eventbrite
 - Everlane
 - Evernote
 - Expedia
 - Expensify
 - Express
 - Express Glasses
 - Eye Buy Direct
 - FabFitFun
 - Fabletics
 - Facet
 - Factor
 - Faherty Brand
 - Faire
 - Fairmont Hotels & Resorts
 - Fancy
 - Farm Rio
 - Fashion Fair
 - Fashion Nova
 - Feedly
 - Feelunique
 - Fenwick
 - Ferrari
 - Figma
 - Finimize
 - Firebox
 - Fitbit
 - Fiverr
 - Flakes
 - Fleur & Bee
 - Flipd
 - Flodesk
 - Fluent
 - Flybe
 - Foodvisor
 - Ford
 - Forest
 - Forest Nation
 - Forever 21
 - Fort Myers
 - Fortnum & Mason
 - Fossil
 - Four Seasons
 - Four Sigmatic
 - Framebridge
 - Framer
 - Free People
 - FreeCodeCamp
 - Freedom Japanese Market
 - Freetrade
 - Fresh Clean Threads
 - Front
 - Ftsny
 - Fullstory
 - Furniture Village
 - Fyrn
 - GMC
 - GQ
 - GameStop
 - Gap
 - GatherContent
 - Genesis
 - Ghia
 - Ghost
 - Ghost Bed
 - GitHub
 - GitLab
 - Glamour
 - Glassdoor
 - Glasses USA
 - Glo
 - Glossier
 - Glossybox
 - Go-Jek
 - GoDaddy
 - Goat
 - Gobble
 - Goggles4u
 - Goldsmiths
 - Good Idea
 - Gorillas
 - Gousto
 - Gozney
 - Grab
 - Graham and Green
 - Grammarly
 - Graze
 - Greats
 - Green Chef
 - GreenRush
 - Groupon
 - Grubhub
 - Guess
 - Gumroad
 - Gymshark
 - Gyroscope
 - H&M
 - H.Samuel
 - HVMN
 - Habitat
 - Happy Viking
 - Harper’s Bazaar
 - Harrods
 - Harry's
 - Harvey Nichols
 - HashiCorp
 - Hastens
 - HauteLook
 - Havn
 - Headspace
 - Height
 - Helix
 - HelloFresh
 - Help Scout
 - Help for Heroes
 - Hershey Park
 - Hettas
 - Hey
 - High Museum of Art
 - Hipmunk
 - Hobby Lobby
 - Hoka
 - Holiday World
 - Home Depot
 - HomeGoods
 - Honda
 - Honest
 - Honey
 - HostGator
 - HotelTonight
 - Hotjar
 - House Curious
 - House of Fraser
 - Houzz
 - HubSpot
 - HubSpot CRM
 - Huel
 - Hulu
 - Hungry House
 - Hutch
 - Hyatt Hotels and Resorts
 - IHG Hotels & Resorts
 - Ikea
 - Imperfect Foods
 - Impossibrew
 - InMotion Hosting
 - InVision
 - Indiana Fever
 - Infoempleo
 - Infojobs
 - Instacart
 - Intelligentsia
 - Interact
 - Intercom
 - Ipsy
 - J.Crew
 - JCPenney
 - Jaguar
 - Jessops
 - Jet2
 - JetBlue
 - Jira
 - Job Today
 - July
 - Jump Bikes
 - Juni
 - Just Eat
 - KEH Camera
 - KETL Mountain Apparel
 - Kate Spade
 - Kay
 - Kennywood
 - Kensington Tours
 - Kentucky Fried Chicken
 - Khan Academy
 - Kin Euphorics
 - Kings Island
 - Klarna
 - Knoebels
 - Kohls
 - Kroger
 - Kuii
 - Kupferberg Center
 - LMNT
 - LTHR Supply
 - La Croix
 - Lamborgini
 - Lancôme
 - Land Rover
 - Landbot
 - Landish
 - Lane Bryant
 - Launchaco
 - Leadpages
 - Leesa
 - Lego
 - Lehman Center for the Performing Arts
 - Lemonade
 - Lexus
 - Liberty London
 - Lifesum
 - Lime
 - Lincoln
 - Lincoln Center Theater
 - Lincoln Center for the Performing Arts
 - Linear
 - Linjer
 - Linktree
 - Liquid I.V.
 - Litmus
 - Loaf
 - London Virgin Hair
 - Loog Guitars
 - Lookfantastic
 - Loom
 - Loot Crate
 - Louis Vuitton
 - Lowes
 - Lucidchart
 - Lululemon
 - Luma
 - Lume Cube
 - Lyft
 - MAC Cosmetics
 - MATE the Label
 - MDMflow
 - MGM Resorts
 - MUD/WTR
 - MVMT
 - Mack Weldon
 - Macy's
 - Made
 - Magento
 - Maggiano’s Little Italy
 - Mailchimp
 - Make
 - Mango
 - MapMyGut
 - Marc Jacobs
 - Market District
 - Marley Spoon
 - Marriott
 - Maserati
 - MasterClass
 - Mattel
 - Mayvenn
 - MeUndies
 - Meadow
 - Medium
 - Mejuri
 - Melissa & Doug
 - Memrise
 - Menards
 - Mercari
 - Mercedes-Benz
 - MetaMask
 - Michaels
 - Microsoft Teams
 - Mingle Mocktails
 - Mini
 - Miro
 - Miss Selfridge
 - Missguided
 - Misto Box
 - Mitsubishi cars
 - Miu Miu
 - Mixpanel
 - Mixtons
 - Moe’s Southwest Grill
 - Moment
 - Monday
 - Moneybox
 - Mont Blanc
 - Monzo
 - Moo
 - Moonpig
 - Morning Brew
 - Morning Recovery
 - Muttonhead
 - My First Wig
 - MyFitnessPal
 - N26
 - NANUK
 - NPR
 - Nars Cosmetics
 - National Geographic
 - NerdWallet
 - Nest Furniture
 - Netflix
 - Netlify
 - New Balance
 - New Look
 - New York City Theatre
 - Newegg
 - Newfields
 - Nicely Noted
 - Nike
 - No Mercy / No Malice
 - Nolan Interior
 - Nomatic
 - Noom
 - Nordstrom
 - Nordstrom Rack
 - Norwegian Cruise Line
 - Notion
 - Notonthehighstreet
 - Now TV
 - Nugg
 - Ocado
 - OfferUp
 - Officevibe
 - Ogee
 - Old Navy
 - Oliver Peoples
 - Omega
 - On
 - Only Natural Pet
 - OpenSea
 - OpenTable
 - Opumo
 - Orange Theory
 - Otiumberg
 - Outdoor Voices
 - Overstock
 - Ozone Socks
 - PBS
 - Paka
 - PandaDoc
 - Pandora
 - Parade
 - Patagonia
 - Patreon
 - Paula's Choice Skincare
 - Paw Patrol
 - PayPal
 - Peloton
 - People
 - Perelman Performing Arts Center (PAC NYC)
 - Persol
 - Pet Supermarket
 - Petco
 - Piada Italian Street Food
 - Picniic
 - Pier 1
 - Pipedrive
 - Pitch
 - Pizza Express
 - Plae
 - Plated
 - Plum
 - Pluralsight
 - Podia
 - Pokemon
 - Poshmark
 - Postmates
 - Pottery Barn
 - Prada
 - PrettyLittleThing
 - Primark
 - Process Street
 - Publix
 - Puma
 - Pure Life
 - Purple
 - QVC
 - Qdoba
 - Quartz
 - Quibi
 - QuickBooks
 - Quill
 - Quip
 - Quizlet
 - Quora
 - REI Co-op
 - Racket
 - Raleigh Limited
 - RallyUp
 - Rare Beauty
 - Ray-Ban
 - Raymond Weil
 - Reader’s Digest
 - Red Robin
 - Redbubble
 - Reebok
 - Reflectly
 - Remitly
 - Replit
 - RescueTime
 - Retool
 - Revolut
 - Revolve
 - Rezi
 - Ripcurl
 - Ritual Zero Proof
 - Road Scholar
 - Robinhood
 - Rock Grace
 - Rootless
 - Rosewood Hotels & Resorts
 - Royal Caribbean Cruises
 - Rumpl
 - Runkeeper
 - Ruth’s Chris
 - SNKRS by Nike
 - Saks Fifth Avenue
 - Sally Beauty
 - Samsonite
 - Saratoga
 - SavvyCal
 - Scentbird
 - Schoolhouse
 - Scribd
 - Sea World
 - Seamless
 - Search Metrics
 - Seedlip
 - Segment
 - Selfridges
 - Sentry
 - Sephora
 - ServiceNow
 - Shark
 - Shein
 - Shift
 - Shop.com
 - Shopify
 - Shpock
 - Shudder
 - Shwood and Stanley
 - Sierra Club
 - Silver Dollar City
 - Simba
 - Six Flags
 - Skechers
 - Skillshare
 - Skims
 - Skyscanner
 - Slack
 - Slite
 - Smartsheet
 - Smiley Movement
 - Smithsonian Institute
 - Snapchat
 - Sneaker Politics
 - Snowe
 - Snowflake
 - Society6
 - Sock Fancy
 - Soka Home
 - SoloLearn
 - Soludos
 - Sonno
 - SoundCloud
 - Southern Living
 - Southwest
 - Soylent
 - Spacegoods
 - Sparkling Ice
 - SpeedWeed
 - Spotify
 - Spreadshirt
 - Spyder
 - Square
 - Squarespace
 - Squarespace Scheduling
 - St Elmo Steakhouse
 - St. Jude
 - Stanley
 - Staples
 - Starbucks
 - Steam
 - Stitch Fix
 - Stojo
 - Stone Forest
 - Strava
 - Strikingly
 - Stripe
 - Substack
 - SumUp
 - Sun Basket
 - SunGod
 - Sunglass Hut
 - Sunsama
 - Superdrug
 - SurveyMonkey
 - Swarovski
 - Sweatcoin
 - Swoon
 - Symphony Space
 - TRNK
 - Tag Heuer
 - Tally
 - Target
 - Taste Trunk
 - Teachable
 - Teachlr
 - Techcrunch
 - Technics
 - Tecovas
 - Ted Baker
 - TeePublic
 - Tempur
 - Tempur-Pedic
 - Temu
 - Terrain
 - Tesla
 - The Absorption Company
 - The Children’s Museum of Indianapolis
 - The Farmers Dog
 - The Hustle
 - The Jewel Hut
 - The Metropolitan Museum of Art (The Met)
 - The Museum of Modern Art (MoMA)
 - The New York Times
 - The North Face
 - The Ordinary
 - The White Company
 - Thinx
 - Threadless
 - Three Spirit
 - Thryve
 - Tidal
 - Tide.fm
 - Tiffany & Co
 - TikTok
 - Tinder
 - Todoist
 - Toggl Track
 - Tom Ford
 - Tommy John
 - Topshop
 - Tory Burch
 - TouchNote
 - Trader Joe’s
 - Trainline
 - TransferWise
 - Travelpro
 - Trello
 - Triibe
 - TripAdvisor
 - Trivago
 - Trustpilot
 - Tuft & Needle
 - Tumi
 - Tunnel to Towers
 - TunnelBear
 - Twilio
 - Twitch
 - Typeform
 - Typhur
 - UGG
 - UNICEF USA
 - UNIQLO
 - Uber
 - Uber Eats
 - Udacity
 - Udemy
 - Ulta
 - Unbounce
 - Unboxme
 - UncommonGoods
 - Under Armour
 - United
 - Universe
 - Upwork
 - Urban Outfitters
 - Us Weekly
 - VIIA
 - VSCO
 - Vanity Fair
 - Vans
 - Veer
 - Vercel
 - Vessi
 - Victoria's Secret
 - Viking Cruises
 - Vimeo
 - Vineyard Vines
 - Vinted
 - Viome
 - Virgin Atlantic
 - Vistaprint
 - Vogue
 - Volvo
 - Voog
 - Vueling
 - W
 - WE
 - WW (Weight Watchers)
 - WalMart
 - Walgreens
 - Wallapop
 - Wallshoppe
 - Walt Disney World Resort
 - Warby Parker
 - Watch Shop
 - Watch Station
 - Watches.com
 - Wattpad
 - Wayfair
 - Waze
 - We Feed Raw
 - Wealthsimple
 - Webflow
 - Weebly
 - Wegmans
 - Wendy’s
 - West Elm
 - Which Wich
 - Whimsical
 - Wikimedia Foundation
 - Williams Sonoma
 - Winc
 - Windstar Cruises
 - Wise
 - Wistia
 - Wix
 - WooCommerce
 - Wooden Spoon Herbs
 - WordPress
 - World Market
 - World Wildlife Fund
 - Wowcher
 - YNAB
 - Yelp
 - Yeti
 - YouTube
 - YouTube Music
 - Zales
 - Zapier
 - Zara
 - Zazzle
 - Zeelool
 - Zendesk
 - Zero
 - Zillow
 - Zoe & Morgan
 - Zoom
 - Zoopla
 - Zulily
 - allure
 - eBay
 - eToro
 - hiyo
 - omnisend
 - reggie
 - uBiome
 
BBC iPlayer Registered user
@uifeed.com
Subscribed 4 years, 7 months ago
<!DOCTYPE html>
<html lang="en">
 <head>
  <meta content="text/html; charset=utf-8"/>
  <meta content="width=device-width, initial-scale=1.0" name="viewport"/>
  <!--[if !mso]><!-- -->
  <meta content="IE=edge"/>
  <!--<![endif]-->
  <meta content="telephone=no, date=no, address=no, email=no, url=no" name="format-detection"/>
  <meta name="x-apple-disable-message-reformatting"/>
  <meta content="light dark" name="color-scheme"/>
  <meta content="light dark" name="supported-color-schemes"/>
  <!--Built in London by the ActionRocket team - @ActionRocket -->
  <style>
   body{margin:0;padding:0}
    *{box-sizing:border-box}
    table{border-collapse:collapse;mso-table-lspace:0;mso-table-rspace:0}
    img{border-radius:3px}
    .button img{border-radius:0}
    u+.body a{color:inherit;text-decoration:none;font-size:inherit;font-weight:inherit;line-height:inherit}
    .bg{background-repeat:no-repeat;background-size:contain;background-image:url(https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FIX5fh9sIRV659gP17R7Afw%252Ffd0c00eb-39df-4bd0-8179-d3309bc5e666/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzU5MzU1Mn0:1uicIO:yA_MUykmColNOndh8hilC4pf9lO7kQMAtc9P-G9YUo4);max-width:800px;background-color:#141414 }
  </style>
  <style>
   div[style*="margin: 16px 0"]{margin:0!important}
    a[x-apple-data-detectors]{color:inherit!important;text-decoration:none!important;font-size:inherit!important;font-family:inherit!important;font-weight:inherit!important;line-height:inherit!important}
    span.MsoHyperlink{color:inherit!important;mso-style-priority:99!important}
    span.MsoHyperlinkFollowed{color:inherit!important;mso-style-priority:99!important}
    a{color:inherit!important;mso-color-alt:windowtext;text-decoration:none}
  </style>
  <style>
   @media screen {
      @font-face{font-family:'bbcreithsansabd';src:url(https://inboxflows.com/_/image/https%253A%252F%252Fstatic.files.bbci.co.uk%252Ffonts%252Freith%252F2.512%252FBBCReithSans_W_Bd.woff2/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZzdGF0aWMuZmlsZSIsInRpbWUiOjE3NTQyNDEyOTIuMzYwMzc0fQ:1uicIO:sLdf4IpWbB1ixKmFOYI0lcNe59HNy4Ah2cmVNiewWcg) format("woff2");font-weight:bold}
      @font-face{font-family:'bbcreithsansrg1';src:url(https://inboxflows.com/_/image/https%253A%252F%252Fstatic.files.bbci.co.uk%252Ffonts%252Freith%252F2.512%252FBBCReithSans_W_Rg.woff2/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZzdGF0aWMuZmlsZSIsInRpbWUiOjE3NTQyNDEyOTIuMzYwNjY4N30:1uicIO:QOiyKJZ10CADoI1wLxR-DIASaxvMJW_HaYR6XGrYPw8) format("woff2");font-weight:normal}
      @font-face{font-family:'bbcreithserifbd';src:url(https://inboxflows.com/_/image/https%253A%252F%252Fstatic.files.bbci.co.uk%252Ffonts%252Freith%252F2.512%252FBBCReithSerif_W_Bd.woff2/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZzdGF0aWMuZmlsZSIsInRpbWUiOjE3NTQyNDEyOTIuMzYwOTExOH0:1uicIO:MQJj7OGL092BR6Ckrk3MbEAvLbCOEsvaILF2-F3sRTo) format("woff2");font-weight:bold}
      @font-face{font-family:'bbcreithserifmd';src:url(https://inboxflows.com/_/image/https%253A%252F%252Fstatic.files.bbci.co.uk%252Ffonts%252Freith%252F2.512%252FBBCReithSerif_W_Md.woff2/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZzdGF0aWMuZmlsZSIsInRpbWUiOjE3NTQyNDEyOTIuMzYxMTMxNH0:1uicIO:KVJPYhLorg2L_Rvgm-7HIiPDT2InXB9M5Ki_lBeice4) format("woff2");font-weight:normal}
    }
  </style>
  <style>
   @media screen and (max-width:800px) {
    .headerimg{width:100%!important;min-width:100%!important;max-width:1000px!important;height:auto!important}
    }
    @media screen and (max-width:720px) {
    .wrapto100pc{width:100%!important;min-width:100%!important;max-width:1000px!important;height:auto!important}
    }
    @media screen and (max-width:640px) {
    .w100pc{width:100%!important;min-width:100%!important;max-width:1000px!important;height:auto!important}
    .w100pcbutton{width:100%!important;max-width:340px!important}
    .show{display:block!important;overflow:visible!important;float:none!important;width:100%!important;height:auto!important;max-height:inherit!important}
    .nomob{display:none!important}
    .colsplit{width:100%!important;float:left!important;display:block!important}
    .theight{height:70px}
    .odd{background:#202224!important}
    .even{background:transparent!important}
    .colsplit-top{width:100%!important;display:table-row-group!important}
    .colsplit-bottom{width:100%!important;display:table-footer-group!important}
    .mobpad{padding-left:0!important;padding-right:0!important}
    h1{font-size:30px!important;line-height:36px!important}
    h2{font-size:26px!important;line-height:32px!important}
    h4+p,.footertext{margin:0!important}
    .w80{width:80px!important;height:auto!important}
    .w260{width:260px!important}
    .w300{width:300px!important}
    .buttonpad{padding:0 12px 30px!important}
    .listpad{padding-bottom:40px!important}
    .nobg{background-image:none!important;padding-bottom:32px}
    .sidepad{width:16px!important}
    .txtcenter{text-align:center}
    .logopad{padding-bottom:6px}
    .footerlink{display:block!important;padding:16px;margin:10px 0;background:#323232;text-align:center!important;}
    .more{width:145px!important;min-width:145px!important}
    .pr10{padding-right:10px!important}
    .pb10{padding-bottom:10px!important}
    .gap{width:3vw!important}
    .br-3{border-radius:3px!important}
    .brtop-3{border-top-left-radius:3px!important;border-top-right-radius:3px!important}
    .brbot-3{border-bottom-left-radius:3px!important;border-bottom-right-radius:3px!important}
    .showmob {display:block!important}
    .mobwatch {padding:16px 16px 13px !important}   
    .watchradius {border-radius: 3px 3px 0 0;}         
    .app-mob-width {width: 200px !important;}        
    .mob-app-padding {padding: 16px 0 14px 15px !important;}  
    .padside {padding-left: 20px !important; padding-right: 20px !important;} 
    .pb20 {padding-bottom: 20px !important;}    
    .bot-radius-3 {border-radius: 0 0 3px 3px !important;}
    .pt20 {padding-top: 20px !important;}   
      .width10 {width: 10px !important;}  
    #MessageViewBody,#MessageWebViewDiv{width:100%!important}
    }
    @media screen and (max-width:340px) {
    .stream{width:100%!important;display:block!important}
    .streamimg{width:200px!important;}
    .padtop{padding-top:35px!important;padding-bottom:35px!important}
    .pad10{padding-left:10px!important;padding-right:10px!important}
    }
  </style>
  <style>
   :root{color-scheme:light dark;supported-color-schemes:light dark}
    @media (prefers-color-scheme: dark) {
    .lightimage{display:none!important}
    .darkimageWrapper,.darkimage,.nomobdarkimage{display:block!important}
    body{background-color:rgb(19,17,17)!important}
    td,th{background-color:rgb(21,19,18)!important}
    *{color:rgb(255,255,255)!important}
    .button{background-color:#202224!important;background-image:linear-gradient(rgb(32,34,36),rgb(32,34,36))!important}
    .button-blue{background-color:#0078ff!important;background-image:linear-gradient(rgb(0,120,255),rgb(0,120,255))!important;border-color:transparent!important}
    .branddark-bg{background-color:#ff4c98!important}
    .branddark-border{border-color:#ff4c98!important}
    .light-bg,.dm-tab{background-color:#202224!important}
    .light,.light-bg td,.light-bg th{background-color:transparent!important;background-image:none!important;border-color:transparent!important}
    .hidebg{background-image:none!important}
    }
          @media (prefers-color-scheme: dark) and (max-width: 640px) {
          .nomobdarkimage {display: none !important;}
         .mobdarkimage {display: block !important;}
      }  
      
    [data-ogsc] .lightimage{display:none!important}
    [data-ogsc] .darkimageWrapper,[data-ogsc] .darkimage{display:block!important}
    [data-ogsb] td,[data-ogsb] th{background-color:rgb(21,19,18)!important}
    [data-ogsb]{color:rgb(255,255,255)!important}
    [data-ogsb] .button{background-color:#202224!important;background-image:linear-gradient(rgb(32,34,36),rgb(32,34,36))!important;border-color:#202224!important}
    [data-ogsb] .button-blue{background-color:#0078ff!important;background-image:linear-gradient(rgb(0,120,255),rgb(0,120,255))!important;border-color:transparent!important}
    [data-ogsb] .branddark-bg{background-color:#ff4c98!important}
    [data-ogsb] .branddark-border{border-color:#ff4c98!important}
    [data-ogsb] .light-bg,[data-ogsb] .dm-tab{background-color:#202224!important}
    [data-ogsb] .light,[data-ogsb] .light-bg td,[data-ogsb] .light-bg th{background-color:transparent!important}
    [data-ogsb] .hidebg{background-image:none!important}
    @media (max-width: 640px) and (prefers-color-scheme: dark) {
    .dm-tab{background-color:transparent!important}
    .odd{background-color:#202224!important}
    }
    @media screen and (max-width: 640px) {
    [data-ogsb] .dm-tab{background-color:transparent!important}
    [data-ogsb] .odd{background-color:#202224!important}
    }
  </style>
  <style>
   u+.body .blendscreen{background:#000;mix-blend-mode:screen}
    u+.body .blenddiff{background:#000;mix-blend-mode:difference}
    u+.body .hidebg-gmail{background-image:none!important}
      
    @media screen and (max-width: 640px){
    u+.body .gmail-hide {display: none !important} 
    u+.body .gmail-show {display: block !important}
    u+.body .mob-app-banner-image {background-image: none !important; border-radius: 3px 3px 0 0 !important;}  
    u+.body .app-mob-width {width: 100% !important;}  
    }
  </style>
  <!--[if (mso)|(mso 16)]> <style> a {text-decoration: none;} </style> <![endif]-->
  <!--[if gte mso 9]><xml> <o:OfficeDocumentSettings> <o:AllowPNG/> <o:PixelsPerInch>96</o:PixelsPerInch> </o:OfficeDocumentSettings> </xml><![endif]-->
  <style>
   @supports(--css: variables) {
      .interactive{display:block!important;position:relative!important;max-width:640px!important;width:100%!important}
      @media screen and (max-width: 640px) {
      .slidepad{padding-left:20px!important;padding-right:0!important}
      }
      @media screen and (max-width: 340px) {
      .slidepad{padding-left:10px!important;padding-right:0!important}
      }
    }
  </style>
 </head>
 <body class="body" style="margin:0!important; padding:0!important; width:100%!important;background-color:#212121;">
  <div aria-roledescription="email" lang="en" role="article">
   <div style="display:none">
    Plus, detective dramas with Sarah Lancashire and Idris Elba.
   </div>
   <div style="display:none">
    ͏  ͏  ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏  ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏  ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏  ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏  ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏  ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏  ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏  ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏
   ͏  ͏  ͏  ͏  ͏  ͏
                    
            
                    
            
                    
            
                    
            
                   
   </div>
   <div align="center" style="width:100%;">
    <div class="bg">
     <!--[if true]> 
<table width="100%" cellpadding="0" cellspacing="0" border="0"> 
  <tr> 
    <td> 
    <v:background xmlns:v="urn:schemas-microsoft-com:vml" fill="t"> 
    <v:fill type="tile" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FIX5fh9sIRV659gP17R7Afw%252Ffd0c00eb-39df-4bd0-8179-d3309bc5e666/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzU5MzU1Mn0:1uicIO:yA_MUykmColNOndh8hilC4pf9lO7kQMAtc9P-G9YUo4" color="#212121"/> </v:background> 
<![endif]-->
     <table border="0" cellpadding="0" cellspacing="0" height="100%" width="100%">
      <tbody>
       <tr>
        <td align="center" valign="top">
         <table border="0" cellpadding="0" cellspacing="0" class="wrapto100pc" role="none" style="width: 800px;" width="800">
          <tbody>
           <tr>
            <td align="center" style="background-color: transparent;">
             <!-- Logo -->
             <table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%">
              <tbody>
               <tr>
                <td align="center">
                 <table border="0" cellpadding="0" cellspacing="0" class="wrapto100pc" role="presentation" style="width:720px;" width="720">
                  <tbody>
                   <tr>
                    <td align="center">
                     <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation" style="width:640px;" width="640">
                      <tbody>
                       <tr>
                        <td align="center" style="padding: 30px 50px;">
                         <a data-ua-linkname="bbciplayer_bbciplayermasthead_nogenre" target="_blank" title="BBC iPlayer">
                          <img alt="" class="lightimage" height="85" src="https://inboxflows.com/_/image/https%253A%252F%252Fimage.e.bbcmail.co.uk%252Flib%252Ffe9013727761077872%252Fm%252F51%252Fiplayer-logo-new.png/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZpbWFnZS5lLmJiYyIsInRpbWUiOjE3NTQyNDEyOTIuMzkwNDU0fQ:1uicIO:4u8L2KhfPZkEoS5aLPl1LsYtcsTPqWElPRpUA-0ASOI" style="display:block;border-radius: 0;" width="188"/>
                          <div class="darkimageWrapper" style="mso-hide: all; display: none;">
                           <img alt="" class="darkimage" height="85" src="https://inboxflows.com/_/image/https%253A%252F%252Fimage.e.bbcmail.co.uk%252Flib%252Ffe9013727761077872%252Fm%252F51%252Fiplayer-logo-new.png/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZpbWFnZS5lLmJiYyIsInRpbWUiOjE3NTQyNDEyOTIuMzkwNzM3fQ:1uicIO:ps6_ED0w6liNIgxN1OMOAhxEYFYOxqYfD7ZirIc_mYc" style="display:none;border-radius: 0;" width="188"/>
                          </div>
                         </a>
                        </td>
                       </tr>
                      </tbody>
                     </table>
                    </td>
                   </tr>
                  </tbody>
                 </table>
                </td>
               </tr>
              </tbody>
             </table>
             <!-- /Logo -->
             <!-- Heading -->
             <table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%">
              <tbody>
               <tr>
                <td align="center">
                 <table border="0" cellpadding="0" cellspacing="0" class="wrapto100pc" role="presentation" style="width:720px;" width="720">
                  <tbody>
                   <tr>
                    <td align="center" class="pad10" style="padding: 0 20px;">
                     <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation" style="width:640px;" width="640">
                      <tbody>
                       <tr>
                        <td align="center" style="padding-bottom: 30px;">
                         <h2 style="font-family:'bbcreithsansabd', Helvetica, Arial, sans-serif;font-size:48px;line-height:54px;color:#fff;margin:0;font-weight:bold;">
                          <a data-ua-linkname="bbciplayer_bbciplayermasthead_nogenre" target="_blank" title="New & Trending">
                           New & Trending
                          </a>
                         </h2>
                        </td>
                       </tr>
                      </tbody>
                     </table>
                    </td>
                   </tr>
                  </tbody>
                 </table>
                </td>
               </tr>
              </tbody>
             </table>
             <!-- /Heading -->
             <!-- Full width hero -->
             <table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%">
              <tbody>
               <tr>
                <td align="center">
                 <table border="0" cellpadding="0" cellspacing="0" class="wrapto100pc" role="presentation" style="width:720px;" width="720">
                  <tbody>
                   <tr>
                    <td align="center" class="pad10" style="padding:0 20px 50px;">
                     <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation" style="width:640px;" width="640">
                      <tbody>
                       <tr>
                        <td>
                         <!-- Image -->
                         <a data-ua-linkname="bbcone_destinationxseries1robbrydontravelcompetitivereality_entertainmentcomp" target="_blank" title="Destination X">
                          <img alt="Destination X" class="w100pc" height="320" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FV0Qxw0oTSXem8eOBxv8BSQ%252F4f83bd37-1b67-4e80-bc65-1400dd0cfdc8/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkwOTU1fQ:1uicIO:cKwXuPxd2Mt9vs219B_A8e8_Xj1YFxcOJGEcg9KI9Zk" style="display:block;" title="Destination X" width="640"/>
                         </a>
                         <!-- Eyebrow -->
                         <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:14px;line-height:20px;color:#b3b7c3;margin: 16px 0 0 0;font-weight:bold;text-transform:uppercase;">
                          A MYSTERIOUS ADVENTURE
                         </p>
                         <!-- Subtitle -->
                         <h3 style="font-family:'bbcreithsansabd',Helvetica,Arial,sans-serif;font-size:20px;line-height:26px;color:#fff;margin:0 0 10px 0;font-weight:bold;">
                          <a data-ua-linkname="bbcone_destinationxseries1robbrydontravelcompetitivereality_entertainmentcomp" style="color:#fff;text-decoration:none;" target="_blank" title="Rob Brydon hosts the ultimate travel game">
                           Rob Brydon hosts the ultimate travel game
                          </a>
                         </h3>
                         <!-- Copy -->
                         <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:14px;line-height:20px;color:#fff;margin:0 0 16px 0;">
                          Thirteen adventurers. One epic journey across Europe. But with blacked-out windows and cryptic challenges, they have no idea where they are - and guessing wrong means elimination. This thrilling new competition is packed with high-stakes challenges, clever clues, and devious red herrings. The prize? £100,000 and the glory of being the last one left on the bus. Will they work together or lead each other astray? And can you figure out their location before they do?
                         </p>
                        </td>
                       </tr>
                       <!-- CTA -->
                       <tr>
                        <td>
                         <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation">
                          <tbody>
                           <tr>
                            <th align="center" class="colsplit" style="font-weight:normal;">
                             <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation">
                              <tbody>
                               <tr>
                                <td align="center">
                                 <table border="0" cellpadding="0" cellspacing="0" class="w100pc button branddark-border" role="presentation" style="border-bottom: 3px solid #ff4c98;background:#202224;">
                                  <tbody>
                                   <tr>
                                    <td align="center" class="button" style="padding: 16px 20px 13px">
                                     <table border="0" cellpadding="0" cellspacing="0" role="presentation">
                                      <tbody>
                                       <tr>
                                        <td class="button">
                                         <p style="font-family:'bbcreithsansabd', Helvetica, Arial, sans-serif;font-size:18px;line-height:18px;color:#fff;margin:0;font-weight:bold;">
                                          <a data-ua-linkname="bbcone_destinationxseries1robbrydontravelcompetitivereality_entertainmentcomp" style="color:#fff;text-decoration: none;" target="_blank" title="Watch now">
                                           Watch now
                                          </a>
                                         </p>
                                        </td>
                                       </tr>
                                      </tbody>
                                     </table>
                                    </td>
                                   </tr>
                                  </tbody>
                                 </table>
                                </td>
                               </tr>
                              </tbody>
                             </table>
                            </th>
                           </tr>
                          </tbody>
                         </table>
                        </td>
                       </tr>
                       <!-- /CTA -->
                      </tbody>
                     </table>
                    </td>
                   </tr>
                  </tbody>
                 </table>
                </td>
               </tr>
              </tbody>
             </table>
             <!-- Full width hero -->
             <!-- Two hander -->
             <table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%">
              <tbody>
               <tr>
                <td align="center">
                 <table border="0" cellpadding="0" cellspacing="0" class="wrapto100pc" role="presentation" style="width:720px;" width="720">
                  <tbody>
                   <tr>
                    <td align="center" class="pad10" style="padding: 0 20px 50px;">
                     <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation" style="width:640px;" width="640">
                      <!-- Heading -->
                      <tbody>
                       <tr>
                        <td>
                         <h2 style="font-family:'bbcreithsansabd', Helvetica, Arial, sans-serif;font-size:34px;line-height:40px;color:#fff;margin:0 0 16px 0;font-weight:bold;" title="">
                          Crimes & cults
                         </h2>
                        </td>
                       </tr>
                       <tr>
                        <td>
                         <table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%">
                          <tbody>
                           <tr>
                            <th align="center" class="colsplit" style="font-weight:normal;vertical-align:top;">
                             <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation" style="width:310px;" width="310">
                              <!-- Image -->
                              <tbody>
                               <tr>
                                <td style="padding-bottom: 16px;">
                                 <a data-ua-linkname="bbctwo_themoorsmurdersasearchforjusticeianbradyhindleymyrahindleytruecrime_factualdocumentaries" target="_blank" title="The Moors Murders">
                                  <img alt="The Moors Murders" class="w100pc" height="174" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FV0Qxw0oTSXem8eOBxv8BSQ%252F8e907374-1b08-4934-8d87-df879e3885d4/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkxMTMxOX0:1uicIO:p-IH991H-mGGF5mJ79SCWBRKIag2CT-FyEz1dwQdA8A" style="display:block;" title="The Moors Murders" width="310"/>
                                 </a>
                                </td>
                               </tr>
                               <!-- /Image -->
                               <tr>
                                <td>
                                 <!-- Eyebrow column 1 -->
                                 <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:14px;line-height:20px;color:#b3b7c3;margin:0;font-weight:bold;text-transform:uppercase;">
                                  A SEARCH FOR JUSTICE
                                 </p>
                                 <!-- Heading column 1 -->
                                 <h3 style="font-family:'bbcreithsansabd',Helvetica,Arial,sans-serif;font-size:20px;line-height:26px;color:#fff;margin:0 0 10px 0;font-weight:bold;">
                                  <a data-ua-linkname="bbctwo_themoorsmurdersasearchforjusticeianbradyhindleymyrahindleytruecrime_factualdocumentaries" style="color:#fff;text-decoration:none;" target="_blank" title="The Moors Murders">
                                   The Moors Murders
                                  </a>
                                 </h3>
                                 <!-- Copy column 1 -->
                                 <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:14px;line-height:20px;color:#fff;margin:0 0 16px 0;" title="">
                                  Drawing on newly discovered documents and recordings of infamous child killers Ian Brady and Myra Hindley, this documentary explores missed opportunities in the original investigation while uncovering new evidence that could reignite the search for the final missing victim.
                                 </p>
                                </td>
                               </tr>
                               <!-- CTA -->
                               <tr>
                                <td>
                                 <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation">
                                  <tbody>
                                   <tr>
                                    <td align="center">
                                     <table border="0" cellpadding="0" cellspacing="0" class="w100pc button branddark-border" role="presentation" style="border-bottom: 3px solid #ff4c98;background:#202224;">
                                      <tbody>
                                       <tr>
                                        <td align="center" class="button" style="padding: 16px 20px 13px">
                                         <table border="0" cellpadding="0" cellspacing="0" role="presentation">
                                          <tbody>
                                           <tr>
                                            <td class="button">
                                             <p style="font-family:'bbcreithsansabd', Helvetica, Arial, sans-serif;font-size:18px;line-height:18px;color:#fff;margin:0;font-weight:bold;">
                                              <a data-ua-linkname="bbctwo_themoorsmurdersasearchforjusticeianbradyhindleymyrahindleytruecrime_factualdocumentaries" style="color:#fff;text-decoration: none;" target="_blank" title="Watch now">
                                               Watch now
                                              </a>
                                             </p>
                                            </td>
                                           </tr>
                                          </tbody>
                                         </table>
                                        </td>
                                       </tr>
                                      </tbody>
                                     </table>
                                    </td>
                                   </tr>
                                  </tbody>
                                 </table>
                                </td>
                               </tr>
                               <!-- /CTA -->
                              </tbody>
                             </table>
                            </th>
                            <th class="colsplit" style="font-weight:normal;height:50px;width:20px;">
                            </th>
                            <th align="center" class="colsplit" style="font-weight:normal;vertical-align:top;">
                             <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation" style="width:310px;" width="310">
                              <!-- Image -->
                              <tbody>
                               <tr>
                                <td style="padding-bottom: 16px;">
                                 <a data-ua-linkname="bbctwo_insidethecultofthejesusarmytruecrime_factualdocumentaries" target="_blank" title="Inside the Cult of the Jesus Army">
                                  <img alt="Inside the Cult of the Jesus Army" class="w100pc" height="174" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FV0Qxw0oTSXem8eOBxv8BSQ%252Fbdfd839d-e0d5-4419-8787-9f7a9613ee1b/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkxMzA2fQ:1uicIO:qD1justLkJleAda0FG_KeHYzoIrsGFx21B2WQ-FUZO8" style="display:block;" title="Inside the Cult of the Jesus Army" width="310"/>
                                 </a>
                                </td>
                               </tr>
                               <!-- /Image -->
                               <tr>
                                <td>
                                 <!-- Eyebrow column 2 -->
                                 <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:14px;line-height:20px;color:#b3b7c3;margin:0;font-weight:bold;text-transform:uppercase;">
                                  INSIDE THE CULT OF THE JESUS ARMY
                                 </p>
                                 <!-- Heading column 2 -->
                                 <h3 style="font-family:'bbcreithsansabd',Helvetica,Arial,sans-serif;font-size:20px;line-height:26px;color:#fff;margin:0 0 10px 0;font-weight:bold;">
                                  <a data-ua-linkname="bbctwo_insidethecultofthejesusarmytruecrime_factualdocumentaries" style="color:#fff;text-decoration:none;" target="_blank" title="Shocking abuse">
                                   Shocking abuse
                                  </a>
                                 </h3>
                                 <!-- Copy column 2 -->
                                 <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:14px;line-height:20px;color:#fff;margin:0 0 16px 0;">
                                  'We could hear the screams.' It began with a dream of heaven on earth in rural Britain. This documentary uncovers the origins of the Jesus Fellowship, where an early vision of communal living and spiritual commitment gradually turned more disciplined, controlling and violent.
                                 </p>
                                </td>
                               </tr>
                               <!-- CTA -->
                               <tr>
                                <td>
                                 <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation">
                                  <tbody>
                                   <tr>
                                    <td align="center">
                                     <table border="0" cellpadding="0" cellspacing="0" class="w100pc button branddark-border" role="presentation" style="border-bottom: 3px solid #ff4c98;background:#202224;">
                                      <tbody>
                                       <tr>
                                        <td align="center" class="button" style="padding: 16px 20px 13px">
                                         <table border="0" cellpadding="0" cellspacing="0" role="presentation">
                                          <tbody>
                                           <tr>
                                            <td class="button">
                                             <p style="font-family:'bbcreithsansabd', Helvetica, Arial, sans-serif;font-size:18px;line-height:18px;color:#fff;margin:0;font-weight:bold;">
                                              <a data-ua-linkname="bbctwo_insidethecultofthejesusarmytruecrime_factualdocumentaries" style="color:#fff;text-decoration: none;" target="_blank" title="Watch now">
                                               Watch now
                                              </a>
                                             </p>
                                            </td>
                                           </tr>
                                          </tbody>
                                         </table>
                                        </td>
                                       </tr>
                                      </tbody>
                                     </table>
                                    </td>
                                   </tr>
                                  </tbody>
                                 </table>
                                </td>
                               </tr>
                               <!-- /CTA -->
                              </tbody>
                             </table>
                            </th>
                           </tr>
                          </tbody>
                         </table>
                        </td>
                       </tr>
                      </tbody>
                     </table>
                    </td>
                   </tr>
                  </tbody>
                 </table>
                </td>
               </tr>
              </tbody>
             </table>
             <!-- /Two hander -->
             <!-- 50/50 Descriptive -->
             <table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%">
              <tbody>
               <tr>
                <td align="center">
                 <table border="0" cellpadding="0" cellspacing="0" class="wrapto100pc" role="presentation" style="width:720px;" width="720">
                  <tbody>
                   <tr>
                    <td align="center" class="pad10" style="padding: 0 20px 50px;">
                     <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation" style="width:640px;" width="640">
                      <!-- Main title -->
                      <tbody>
                       <tr>
                        <td>
                         <h2 style="font-family:'bbcreithsansabd', Helvetica, Arial, sans-serif;font-size:34px;line-height:40px;color:#fff;margin:0 0 16px 0;font-weight:bold;">
                          Tune in for a twist
                         </h2>
                        </td>
                       </tr>
                       <!-- /Main title -->
                       <tr>
                        <td>
                         <table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%">
                          <tbody>
                           <tr>
                            <!-- Image left -->
                            <th align="center" class="colsplit" style="font-weight:normal;vertical-align:top;">
                             <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation" style="width:310px;" width="310">
                              <tbody>
                               <tr>
                                <td>
                                 <a data-ua-linkname="bbc_tvlicensingcampaign2025_corporatemessaging" target="_blank" title="Are you covered for thrilling TV?">
                                  <img alt="Are you covered for thrilling TV?" class="w100pc" height="174" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FV0Qxw0oTSXem8eOBxv8BSQ%252F6ad274f6-63b9-4606-8c40-4b3f7c4a5e32/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkxNDg4fQ:1uicIO:VpIWtxtvMluJB48nay5RBH3sCf-A2_fR-7somumfbHQ" style="display:block;" title="Are you covered for thrilling TV?" width="310"/>
                                 </a>
                                </td>
                               </tr>
                              </tbody>
                             </table>
                            </th>
                            <th class="colsplit" style="font-weight:normal;width:20px;height:16px;">
                            </th>
                            <!-- /Image left -->
                            <th align="center" class="colsplit" style="font-weight:normal; vertical-align: top;">
                             <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation" style="width:310px;" width="310">
                              <tbody>
                               <tr>
                                <td>
                                 <!-- Eyebrow -->
                                 <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:14px;line-height:20px;color:#b3b7c3;margin:0;font-weight:bold;text-transform:uppercase;">
                                  TV LICENSING
                                 </p>
                                 <!-- Subtitle -->
                                 <h3 style="font-family:'bbcreithsansabd',Helvetica,Arial,sans-serif;font-size:20px;line-height:26px;color:#fff;margin:0 0 10px 0;font-weight:bold;">
                                  <a data-ua-linkname="bbc_tvlicensingcampaign2025_corporatemessaging" style="color:#fff;text-decoration:none;" target="_blank" title="Are you covered for thrilling TV?">
                                   Are you covered for thrilling TV?
                                  </a>
                                 </h3>
                                 <!-- Copy -->
                                 <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:14px;line-height:20px;color:#fff;margin:0 0 16px 0;">
                                  EastEnders cliffhangers, football knockouts, Destination X reveals. You'll never guess what happens next. Explore it all with a TV Licence.
                                 </p>
                                </td>
                               </tr>
                               <!-- CTA -->
                               <tr>
                                <td>
                                 <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation">
                                  <tbody>
                                   <tr>
                                    <td align="center">
                                     <table border="0" cellpadding="0" cellspacing="0" class="w100pc button branddark-border" role="presentation" style="border-bottom: 3px solid #ff4c98;background:#202224;">
                                      <tbody>
                                       <tr>
                                        <td align="center" class="button" style="padding: 16px 20px 13px">
                                         <table border="0" cellpadding="0" cellspacing="0" role="presentation">
                                          <tbody>
                                           <tr>
                                            <td class="button">
                                             <p style="font-family:'bbcreithsansabd', Helvetica, Arial, sans-serif;font-size:18px;line-height:18px;color:#fff;margin:0;font-weight:bold;">
                                              <a data-ua-linkname="bbc_tvlicensingcampaign2025_corporatemessaging" style="color:#fff;text-decoration: none;" target="_blank" title="Find out more">
                                               Find out more
                                              </a>
                                             </p>
                                            </td>
                                           </tr>
                                          </tbody>
                                         </table>
                                        </td>
                                       </tr>
                                      </tbody>
                                     </table>
                                    </td>
                                   </tr>
                                  </tbody>
                                 </table>
                                </td>
                               </tr>
                               <!-- /CTA -->
                              </tbody>
                             </table>
                            </th>
                           </tr>
                          </tbody>
                         </table>
                        </td>
                       </tr>
                      </tbody>
                     </table>
                    </td>
                   </tr>
                  </tbody>
                 </table>
                </td>
               </tr>
              </tbody>
             </table>
             <!-- / 50/50 Descriptive -->
             <!-- Emoji listicle -->
             <table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%">
              <tbody>
               <tr>
                <td align="center">
                 <table border="0" cellpadding="0" cellspacing="0" class="wrapto100pc" role="presentation" style="width:720px;" width="720">
                  <tbody>
                   <tr>
                    <td align="center" class="pad10" style="padding: 0 20px 50px;">
                     <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation" style="width:640px;" width="640">
                      <!-- Main title -->
                      <tbody>
                       <tr>
                        <td>
                         <h2 style="font-family:'bbcreithsansabd', Helvetica, Arial, sans-serif;font-size:34px;line-height:40px;color:#fff;margin:0 0 16px 0;font-weight:bold;">
                          Elsewhere on iPlayer
                         </h2>
                        </td>
                       </tr>
                       <!-- /Main title -->
                       <!-- Row 1 -->
                       <tr>
                        <td class="button" style="padding:12px 20px;background:#202224; border-top-left-radius: 3px;border-top-right-radius: 3px;">
                         <table border="0" cellpadding="0" cellspacing="0" role="presentation" style="width:100%;" width="100%">
                          <tbody>
                           <tr>
                            <!-- Emoji -->
                            <td class="button" style="width:60px;">
                             <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:36px;line-height:36px;color:#fff;margin:0;">
                              <a data-ua-linkname="bbcone_fakeorfortunethemysteryofchurchillsgardenwinstonchurchill_factualarts" style="color:#fff;text-decoration:none;" target="_blank" title="The Mystery of Churchill's Garden: a £140 painting, a hidden inscription, and a half-million-pound question">
                               🖼️
                              </a>
                             </p>
                            </td>
                            <!-- /Emoji -->
                            <!-- Text -->
                            <td class="button">
                             <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:18px;line-height:24px;color:#fff;margin:0;">
                              <a data-ua-linkname="bbcone_fakeorfortunethemysteryofchurchillsgardenwinstonchurchill_factualarts" style="color:#fff;text-decoration:none;" target="_blank" title="The Mystery of Churchill's Garden: a £140 painting, a hidden inscription, and a half-million-pound question">
                               The Mystery of Churchill's Garden: a £140 painting, a hidden inscription, and a half-million-pound question
                              </a>
                             </p>
                            </td>
                            <!-- /Text -->
                            <!-- Arrow -->
                            <td class="button" style="width: 20px;" width="20">
                             <a data-ua-linkname="bbcone_fakeorfortunethemysteryofchurchillsgardenwinstonchurchill_factualarts" target="_blank" title="The Mystery of Churchill's Garden: a £140 painting, a hidden inscription, and a half-million-pound question">
                              <img alt="The Mystery of Churchill's Garden: a £140 painting, a hidden inscription, and a half-million-pound question" height="22" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FIX5fh9sIRV659gP17R7Afw%252F7afc76a7-0e87-42dc-a8c7-a7dc156e1754/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkxNjgwN30:1uicIO:P2rrtfOxllA21twmujrAkclYVxlP_ezSAbklVK4TMzg" style="display:block;" width="16"/>
                             </a>
                            </td>
                            <!-- /Arrow -->
                           </tr>
                          </tbody>
                         </table>
                        </td>
                       </tr>
                       <!-- /Row 1 -->
                       <!-- Row 2 -->
                       <tr>
                        <td style="padding:12px 20px;">
                         <table border="0" cellpadding="0" cellspacing="0" role="presentation" style="width:100%;" width="100%">
                          <tbody>
                           <tr>
                            <!-- Emoji -->
                            <td style="width:60px;">
                             <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:36px;line-height:36px;color:#fff;margin:0;">
                              <a data-ua-linkname="bbcfour_bbcproms2025thegreatamericansongbookwithsamarajoyfranksinatrabillieholidaydukeellington_musicclassical" style="color:#fff;text-decoration:none;" target="_blank" title="BBC Proms 2025: Grammy-winning sensation Samara Joy sings Billie Holiday, Frank Sinatra and more">
                               🎤
                              </a>
                             </p>
                            </td>
                            <!-- /Emoji -->
                            <!-- Text -->
                            <td>
                             <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:18px;line-height:24px;color:#fff;margin:0;">
                              <a data-ua-linkname="bbcfour_bbcproms2025thegreatamericansongbookwithsamarajoyfranksinatrabillieholidaydukeellington_musicclassical" style="color:#fff;text-decoration:none;" target="_blank" title="BBC Proms 2025: Grammy-winning sensation Samara Joy sings Billie Holiday, Frank Sinatra and more">
                               BBC Proms 2025: Grammy-winning sensation Samara Joy sings Billie Holiday, Frank Sinatra and more
                              </a>
                             </p>
                            </td>
                            <!-- /Text -->
                            <!-- Arrow -->
                            <td style="width: 20px;" width="20">
                             <a data-ua-linkname="bbcfour_bbcproms2025thegreatamericansongbookwithsamarajoyfranksinatrabillieholidaydukeellington_musicclassical" target="_blank" title="BBC Proms 2025: Grammy-winning sensation Samara Joy sings Billie Holiday, Frank Sinatra and more">
                              <img alt="BBC Proms 2025: Grammy-winning sensation Samara Joy sings Billie Holiday, Frank Sinatra and more" height="22" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FIX5fh9sIRV659gP17R7Afw%252F7afc76a7-0e87-42dc-a8c7-a7dc156e1754/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkxODM4Nn0:1uicIO:Vz31Y3FLqXGjpUWTeWnUGmERaQUhS54XKeii605-6Dg" style="display:block;" width="16"/>
                             </a>
                            </td>
                            <!-- /Arrow -->
                           </tr>
                          </tbody>
                         </table>
                        </td>
                       </tr>
                       <!-- /Row 2 -->
                       <!-- Row 3 -->
                       <tr>
                        <td class="button" style="padding:12px 20px;background:#202224; border-top-left-radius: 3px;border-top-right-radius: 3px;">
                         <table border="0" cellpadding="0" cellspacing="0" role="presentation" style="width:100%;" width="100%">
                          <tbody>
                           <tr>
                            <!-- Emoji -->
                            <td class="button" style="width:60px;">
                             <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:36px;line-height:36px;color:#fff;margin:0;">
                              <a data-ua-linkname="bbciplayer_bbcradio1movieswithaliplumbbecomingthefantasticfourpedropascalvanessakirbyjosephquinnebonmossbachrachcinemamarvelsuperhero_entertainment" style="color:#fff;text-decoration:none;" target="_blank" title="Pedro Pascal and Vanessa Kirby share The Fantastic Four filming secrets, including funny moments on set">
                               🎬
                              </a>
                             </p>
                            </td>
                            <!-- /Emoji -->
                            <!-- Text -->
                            <td class="button">
                             <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:18px;line-height:24px;color:#fff;margin:0;">
                              <a data-ua-linkname="bbciplayer_bbcradio1movieswithaliplumbbecomingthefantasticfourpedropascalvanessakirbyjosephquinnebonmossbachrachcinemamarvelsuperhero_entertainment" style="color:#fff;text-decoration:none;" target="_blank" title="Pedro Pascal and Vanessa Kirby share The Fantastic Four filming secrets, including funny moments on set">
                               Pedro Pascal and Vanessa Kirby share The Fantastic Four filming secrets, including funny moments on set
                              </a>
                             </p>
                            </td>
                            <!-- /Text -->
                            <!-- Arrow -->
                            <td class="button" style="width: 20px;" width="20">
                             <a data-ua-linkname="bbciplayer_bbcradio1movieswithaliplumbbecomingthefantasticfourpedropascalvanessakirbyjosephquinnebonmossbachrachcinemamarvelsuperhero_entertainment" target="_blank" title="Pedro Pascal and Vanessa Kirby share The Fantastic Four filming secrets, including funny moments on set">
                              <img alt="Pedro Pascal and Vanessa Kirby share The Fantastic Four filming secrets, including funny moments on set" height="22" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FIX5fh9sIRV659gP17R7Afw%252F7afc76a7-0e87-42dc-a8c7-a7dc156e1754/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkxOTk1NH0:1uicIO:r2CMpbkOII46Zv2vJuXfXd7LCE_3Ma_qJs6uScz6DRI" style="display:block;" width="16"/>
                             </a>
                            </td>
                            <!-- /Arrow -->
                           </tr>
                          </tbody>
                         </table>
                        </td>
                       </tr>
                       <!-- /Row 3 -->
                       <!-- Row 4 -->
                       <tr>
                        <td style="padding:12px 20px;">
                         <table border="0" cellpadding="0" cellspacing="0" role="presentation" style="width:100%;" width="100%">
                          <tbody>
                           <tr>
                            <!-- Emoji -->
                            <td style="width:60px;">
                             <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:36px;line-height:36px;color:#fff;margin:0;">
                              <a data-ua-linkname="bbctwo_whitneyhoustonliveinsouthafrica1994_music" style="color:#fff;text-decoration:none;" target="_blank" title="Whitney Houston made history in 1994 as the first major Western act in post-apartheid South Africa">
                               🇿🇦
                              </a>
                             </p>
                            </td>
                            <!-- /Emoji -->
                            <!-- Text -->
                            <td>
                             <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:18px;line-height:24px;color:#fff;margin:0;">
                              <a data-ua-linkname="bbctwo_whitneyhoustonliveinsouthafrica1994_music" style="color:#fff;text-decoration:none;" target="_blank" title="Whitney Houston made history in 1994 as the first major Western act in post-apartheid South Africa">
                               Whitney Houston made history in 1994 as the first major Western act in post-apartheid South Africa
                              </a>
                             </p>
                            </td>
                            <!-- /Text -->
                            <!-- Arrow -->
                            <td style="width: 20px;" width="20">
                             <a data-ua-linkname="bbctwo_whitneyhoustonliveinsouthafrica1994_music" target="_blank" title="Whitney Houston made history in 1994 as the first major Western act in post-apartheid South Africa">
                              <img alt="Whitney Houston made history in 1994 as the first major Western act in post-apartheid South Africa" height="22" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FIX5fh9sIRV659gP17R7Afw%252F7afc76a7-0e87-42dc-a8c7-a7dc156e1754/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkyMjE4Nn0:1uicIO:S0HdZZ6omdOoA3sfMqb5eGabMi_8Joq2VYtEpXQITmg" style="display:block;" width="16"/>
                             </a>
                            </td>
                            <!-- /Arrow -->
                           </tr>
                          </tbody>
                         </table>
                        </td>
                       </tr>
                       <!-- /Row 4 -->
                       <!-- Row 5 -->
                       <tr>
                        <td class="button" style="padding:12px 20px;background:#202224; border-top-left-radius: 3px;border-top-right-radius: 3px;">
                         <table border="0" cellpadding="0" cellspacing="0" role="presentation" style="width:100%;" width="100%">
                          <tbody>
                           <tr>
                            <!-- Emoji -->
                            <td class="button" style="width:60px;">
                             <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:36px;line-height:36px;color:#fff;margin:0;">
                              <a data-ua-linkname="bbcfour_kamikazeanuntoldstoryworldwartwoww2historykamikaze80thanniversary_factualdocumentaries" style="color:#fff;text-decoration:none;" target="_blank" title="Japanese and US veterans reflect on the 'kamikaze' attacks of WWII, 80 years on">
                               🪖
                              </a>
                             </p>
                            </td>
                            <!-- /Emoji -->
                            <!-- Text -->
                            <td class="button">
                             <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:18px;line-height:24px;color:#fff;margin:0;">
                              <a data-ua-linkname="bbcfour_kamikazeanuntoldstoryworldwartwoww2historykamikaze80thanniversary_factualdocumentaries" style="color:#fff;text-decoration:none;" target="_blank" title="Japanese and US veterans reflect on the 'kamikaze' attacks of WWII, 80 years on">
                               Japanese and US veterans reflect on the 'kamikaze' attacks of WWII, 80 years on
                              </a>
                             </p>
                            </td>
                            <!-- /Text -->
                            <!-- Arrow -->
                            <td class="button" style="width: 20px;" width="20">
                             <a data-ua-linkname="bbcfour_kamikazeanuntoldstoryworldwartwoww2historykamikaze80thanniversary_factualdocumentaries" target="_blank" title="Japanese and US veterans reflect on the 'kamikaze' attacks of WWII, 80 years on">
                              <img alt="Japanese and US veterans reflect on the 'kamikaze' attacks of WWII, 80 years on" height="22" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FIX5fh9sIRV659gP17R7Afw%252F7afc76a7-0e87-42dc-a8c7-a7dc156e1754/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkyMzk5NX0:1uicIO:QhF5nDeAzOP0t5pDQ6QDgRBs9m-W6mUTVff2j9wdqn4" style="display:block;" width="16"/>
                             </a>
                            </td>
                            <!-- /Arrow -->
                           </tr>
                          </tbody>
                         </table>
                        </td>
                       </tr>
                       <!-- /Row 5 -->
                       <!-- Row 6 -->
                       <tr>
                        <td style="padding:12px 20px;">
                         <table border="0" cellpadding="0" cellspacing="0" role="presentation" style="width:100%;" width="100%">
                          <tbody>
                           <tr>
                            <!-- Emoji -->
                            <td style="width:60px;">
                             <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:36px;line-height:36px;color:#fff;margin:0;">
                              <a data-ua-linkname="bbcone_spookskeeleyhawespeterfirthmatthewmacfadyenspydramami5_dramathriller" style="color:#fff;text-decoration:none;" target="_blank" title="Keeley Hawes' iconic 00s spy thriller that dives into the high-stakes world of MI5">
                               🕵️
                              </a>
                             </p>
                            </td>
                            <!-- /Emoji -->
                            <!-- Text -->
                            <td>
                             <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:18px;line-height:24px;color:#fff;margin:0;">
                              <a data-ua-linkname="bbcone_spookskeeleyhawespeterfirthmatthewmacfadyenspydramami5_dramathriller" style="color:#fff;text-decoration:none;" target="_blank" title="Keeley Hawes' iconic 00s spy thriller that dives into the high-stakes world of MI5">
                               Keeley Hawes' iconic 00s spy thriller that dives into the high-stakes world of MI5
                              </a>
                             </p>
                            </td>
                            <!-- /Text -->
                            <!-- Arrow -->
                            <td style="width: 20px;" width="20">
                             <a data-ua-linkname="bbcone_spookskeeleyhawespeterfirthmatthewmacfadyenspydramami5_dramathriller" target="_blank" title="Keeley Hawes' iconic 00s spy thriller that dives into the high-stakes world of MI5">
                              <img alt="Keeley Hawes' iconic 00s spy thriller that dives into the high-stakes world of MI5" height="22" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FIX5fh9sIRV659gP17R7Afw%252F7afc76a7-0e87-42dc-a8c7-a7dc156e1754/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkyNTYzfQ:1uicIO:71c5S_Lyk9D_cltjadbc7Q0M6PVqSg2-NelZP9BKY3Y" style="display:block;" width="16"/>
                             </a>
                            </td>
                            <!-- /Arrow -->
                           </tr>
                          </tbody>
                         </table>
                        </td>
                       </tr>
                       <!-- /Row 6 -->
                      </tbody>
                     </table>
                    </td>
                   </tr>
                  </tbody>
                 </table>
                </td>
               </tr>
              </tbody>
             </table>
             <!-- /Emoji listicle -->
             <!-- Full width hero -->
             <table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%">
              <tbody>
               <tr>
                <td align="center">
                 <table border="0" cellpadding="0" cellspacing="0" class="wrapto100pc" role="presentation" style="width:720px;" width="720">
                  <tbody>
                   <tr>
                    <td align="center" class="pad10" style="padding:0 20px 50px;">
                     <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation" style="width:640px;" width="640">
                      <tbody>
                       <tr>
                        <td>
                         <!-- Title -->
                         <h2 style="font-family:'bbcreithsansabd', Helvetica, Arial, sans-serif;font-size:34px;line-height:40px;color:#fff;margin:0 0 16px 0;font-weight:bold;">
                          Ultimate Detective Picks 🔎
                         </h2>
                         <!-- Image -->
                         <a data-ua-linkname="bbciplayer_ultimatedetectivepickscollection_dramacrime" target="_blank" title="Ultimate Detective Picks">
                          <img alt="Ultimate Detective Picks" class="w100pc" height="320" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FV0Qxw0oTSXem8eOBxv8BSQ%252Fff486498-d198-48fc-94a5-f3186772954b/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkyNzI0OH0:1uicIO:ms-6jaMYu3VsJiczOzzWYM2iqgXUngGHlvpnbokhUJ8" style="display:block;" width="640"/>
                         </a>
                         <!-- Copy -->
                         <p style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:14px;line-height:20px;color:#fff;margin:0 0 16px 0;">
                          <br/>
                          Surrender yourself to the dark side. From Sally Wainwright's northern noir starring James Norton and Sarah Lancashire, to detectives hunting for the truth in a New Zealand town, follow these crime-fighting cops in their tireless pursuit of justice.
                         </p>
                        </td>
                       </tr>
                      </tbody>
                     </table>
                    </td>
                   </tr>
                  </tbody>
                 </table>
                </td>
               </tr>
              </tbody>
             </table>
             <!-- Full width hero -->
             <!-- More from the BBC -->
             <table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%">
              <tr>
               <td align="center" style="background:#141414;">
                <table border="0" cellpadding="0" cellspacing="0" class="wrapto100pc" role="presentation" style="width:720px;" width="720">
                 <tr>
                  <td align="center" class="pad10" style="padding: 0 20px 30px;">
                   <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation" style="width:640px;" width="640">
                    <tr>
                     <td>
                      <h2 style="font-family:'bbcreithsansabd', Helvetica, Arial, sans-serif;font-size:30px;line-height:36px;color:#fff;margin:30px 0;font-weight:bold;text-align:center;">
                       <a alias="bbc_bbcfootermore_nogenre" data-ua-linkname="bbc_bbcfootermore_nogenre" style="color:#fff;text-decoration:none;" target="_blank" title="More from the BBC">
                        More from the BBC
                       </a>
                      </h2>
                     </td>
                    </tr>
                    <tr>
                     <td align="center">
                      <table border="0" cellpadding="0" cellspacing="0" role="presentation">
                       <tr>
                        <td class="pr10 pb10" style="padding:0 20px 20px 0;">
                         <table border="0" cellpadding="0" cellspacing="0" class="more light-bg" height="50" role="presentation" style="width: 200px;min-width: 200px;height:50px;background:#202224;border-radius:3px;" width="200">
                          <tr>
                           <td style="font-family:'bbcreithsansabd', Helvetica, Arial, sans-serif;font-size:18px;line-height:18px;color:#ec5b97;margin:0;font-weight:bold;text-align:center;height:50px;padding: 0 10px;">
                            <a data-ua-linkname="bbciplayer_bbciplayerfooter_nogenre" style="color: #ec5b97;text-decoration: none;" target="_blank" title="iPlayer">
                             <img alt="iPlayer" class="w100pc" height="25" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FIX5fh9sIRV659gP17R7Afw%252F50f628ef-d05d-44bb-90f3-04729590e689/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkyODg4OH0:1uicIO:fmzoFoBnQT-lwKMBl9rFeV-BRYMTkGO-0-Cx54ATB8w" style="border-radius:0;" width="143"/>
                            </a>
                           </td>
                          </tr>
                         </table>
                        </td>
                        <td class="pb10" style="padding-bottom: 20px;">
                         <table border="0" cellpadding="0" cellspacing="0" class="more light-bg" height="50" role="presentation" style="width: 200px;min-width: 200px;height:50px;background:#202224;border-radius:3px;" width="200">
                          <tr>
                           <td style="font-family:'bbcreithsansabd', Helvetica, Arial, sans-serif;font-size:18px;line-height:18px;color:#e96d2c;margin:0;font-weight:bold;text-align:center;height:50px;padding: 0 10px;">
                            <a data-ua-linkname="bbcsounds_bbcsoundsfooter_nogenre" style="color: #e96d2c;text-decoration: none;" target="_blank" title="Sounds">
                             <img alt="Sounds" class="w100pc" height="25" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FIX5fh9sIRV659gP17R7Afw%252F6a4db996-5fdc-4549-a03c-38bc679bab5b/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkzMDU5NX0:1uicIO:6W3Nm8B-oswybEqaDYJ2mbKYyCX5XpZ5r5UIhRKesps" style="border-radius:0;" width="143"/>
                            </a>
                           </td>
                          </tr>
                         </table>
                        </td>
                        <td class="nomob" style="padding-bottom: 20px;">
                         <table border="0" cellpadding="0" cellspacing="0" class="light-bg" height="50" role="presentation" style="width: 200px;min-width: 200px;height:50px;background:#202224;border-radius:3px;" width="200">
                          <tr>
                           <td style="font-family:'bbcreithsansabd', Helvetica, Arial, sans-serif;font-size:18px;line-height:18px;color:#8b46d9;margin:0;font-weight:bold;text-align:center;height:50px;">
                            <a bbcbitesize_bbcbitesizefooter_nogenre="" data-ua-linkname="bbcbitesize_bbcbitesizefooter_nogenre" style="color: #8b46d9;text-decorationalias=" target="_blank" title="Bitesize">
                             <img alt="Bitesize" height="25" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FIX5fh9sIRV659gP17R7Afw%252F817573cc-2cff-4243-a80d-d523c2ce259c/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkzMjIxMX0:1uicIO:f_7B_KIk3_bSHJKB6jL5e23LTtmvWgEqHCbquxOFxq0" style="border-radius:0;" width="147"/>
                            </a>
                           </td>
                          </tr>
                         </table>
                        </td>
                       </tr>
                       <tr>
                        <td colspan="3">
                         <!--[if !mso]><!-->
                         <div class="show" style="display: none;">
                          <table border="0" cellpadding="0" cellspacing="0" role="presentation">
                           <tr>
                            <td style="padding:0 10px 10px 0;">
                             <table border="0" cellpadding="0" cellspacing="0" class="more light-bg" height="50" role="presentation" style="width: 200px;min-width: 200px;height:50px;background:#202224;border-radius:3px;" width="200">
                              <tr>
                               <td style="font-family:'bbcreithsansabd', Helvetica, Arial, sans-serif;font-size:18px;line-height:18px;color:#8b46d9;margin:0;font-weight:bold;text-align:center;height:50px;padding: 0 10px">
                                <a alias="bbcbitesize_bbcbitesizefooter_nogenre" data-ua-linkname="" style="color: #8b46d9;text-decoration: none;" target="_blank" title="Bitesize">
                                 <img alt="Bitesize" class="w100pc" height="25" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FIX5fh9sIRV659gP17R7Afw%252F817573cc-2cff-4243-a80d-d523c2ce259c/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkzMzc2OH0:1uicIO:qsEZrfVjpOROdSluWLKfbZc7ZE0YSAhB7_TMn_gQ4WU" style="border-radius:0;" width="147"/>
                                </a>
                               </td>
                              </tr>
                             </table>
                            </td>
                            <td style="padding-bottom: 10px;">
                             <table border="0" cellpadding="0" cellspacing="0" class="more light-bg" height="50" role="presentation" style="width: 200px;min-width: 200px;height:50px;background:#202224;border-radius:3px;" width="200">
                              <tr>
                               <td style="font-family:'bbcreithsansabd', Helvetica, Arial, sans-serif;font-size:18px;line-height:18px;color:#f8d355;margin:0;font-weight:bold;text-align:center;height:50px;padding: 0 10px">
                                <a alias="bbcsport_bbcsportfooter_nogenre" data-ua-linkname="" style="color: #f8d355;text-decoration: none;" target="_blank" title="Sport">
                                 <img alt="Sport" class="w100pc" height="25" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FIX5fh9sIRV659gP17R7Afw%252Ff1dc3b80-08cf-4684-8aff-b8cbde51884e/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkzNTM2M30:1uicIO:CYgbJmvMVepw8Jac11lJvf2SBqc1Kf2_pe_b5DtPR1U" style="border-radius:0;" width="143"/>
                                </a>
                               </td>
                              </tr>
                             </table>
                            </td>
                           </tr>
                          </table>
                         </div>
                         <!--<![endif]-->
                        </td>
                       </tr>
                       <tr>
                        <td class="nomob" style="padding-right: 20px;">
                         <table border="0" cellpadding="0" cellspacing="0" class="light-bg" height="50" role="presentation" style="width: 200px;min-width: 200px;height:50px;background:#202224;border-radius:3px;" width="200">
                          <tr>
                           <td style="font-family:'bbcreithsansabd', Helvetica, Arial, sans-serif;font-size:18px;line-height:18px;color:#f8d355;margin:0;font-weight:bold;text-align:center;height:50px;">
                            <a data-ua-linkname="bbcsport_bbcsportfooter_nogenre" style="color: #f8d355;text-decoration: none;" target="_blank" title="Sport">
                             <img alt="Sport" height="25" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FIX5fh9sIRV659gP17R7Afw%252Ff1dc3b80-08cf-4684-8aff-b8cbde51884e/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkzNjg4N30:1uicIO:YJBHffA3JMFYNqz1PvDLMjBJac5qESturBtfzxk_o7A" style="border-radius:0;" width="143"/>
                            </a>
                           </td>
                          </tr>
                         </table>
                        </td>
                        <td class="pr10" style="padding-right: 20px;">
                         <table border="0" cellpadding="0" cellspacing="0" class="more light-bg" height="50" role="presentation" style="width: 200px;min-width: 200px;height:50px;background:#202224;border-radius:3px;" width="200">
                          <tr>
                           <td style="font-family:'bbcreithsansabd', Helvetica, Arial, sans-serif;font-size:18px;line-height:18px;color:#479dd7;margin:0;font-weight:bold;text-align:center;height:50px;padding: 0 10px">
                            <a data-ua-linkname="bbcweather_bbcweatherfooter_nogenre" style="color: #479dd7;text-decoration: none;" target="_blank" title="Weather">
                             <img alt="Weather" class="w100pc" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FIX5fh9sIRV659gP17R7Afw%252Fd17c37ec-33b1-4838-9b1b-edb93a6dca15/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkzODQ1fQ:1uicIO:ySgB4_5IehlrKAGjBdRUU7VWvmYFfQEwzhqiAeyyZEo" style="border-radius:0;height:auto" width="165"/>
                            </a>
                           </td>
                          </tr>
                         </table>
                        </td>
                        <td>
                         <table border="0" cellpadding="0" cellspacing="0" class="more light-bg" height="50" role="presentation" style="width: 200px;min-width: 200px;height:50px;background:#202224;border-radius:3px;" width="200">
                          <tr>
                           <td style="font-family:'bbcreithsansabd', Helvetica, Arial, sans-serif;font-size:18px;line-height:18px;color:#d83327;margin:0;font-weight:bold;text-align:center;height:50px;padding: 0 10px">
                            <a data-ua-linkname="bbcnews_bbcnewsfooter_nogenre" style="color: #d83327;text-decoration: none;" target="_blank" title="News">
                             <img alt="News" class="w100pc" height="25" src="https://inboxflows.com/_/image/https%253A%252F%252Fc00097-dl.urbanairship.com%252Fbinary%252Fpublic%252FIX5fh9sIRV659gP17R7Afw%252Fa85c99f9-e295-4d9d-8503-1978e9084930/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZjMDAwOTctZGwudSIsInRpbWUiOjE3NTQyNDEyOTIuMzkzOTk4NH0:1uicIO:LMMpv1mhlNXChbz9bQrLTVFD7OI2UaINDuHhiqF2FGs" style="border-radius:0;" width="143"/>
                            </a>
                           </td>
                          </tr>
                         </table>
                        </td>
                       </tr>
                      </table>
                     </td>
                    </tr>
                   </table>
                  </td>
                 </tr>
                </table>
               </td>
              </tr>
             </table>
             <!-- /More from the BBC -->
             <!-- Footer - Logo and links -->
             <table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%">
              <tr>
               <td align="center" class="light-bg" style="background:#272727;">
                <table border="0" cellpadding="0" cellspacing="0" class="wrapto100pc" role="presentation" style="width:720px;" width="720">
                 <tr>
                  <td align="center" style="padding: 16px 10px;">
                   <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation" style="width:640px;" width="640">
                    <tr>
                     <th align="left" class="colsplit" style="font-weight:normal;">
                      <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation">
                       <tr>
                        <td align="center" class="logopad">
                         <a data-ua-linkname="bbc_bbcfooter_nogenre" target="_blank" title="">
                          <img alt="BBC." height="31" src="https://inboxflows.com/_/image/https%253A%252F%252Fimage.e.bbcmail.co.uk%252Flib%252Ffe9013727761077872%252Fm%252F51%252Fbbc_master.png/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZpbWFnZS5lLmJiYyIsInRpbWUiOjE3NTQyNDEyOTIuMzk0MTU2Mn0:1uicIO:Dg0Fgy2D8iHhrmZv6IGkT4RnZDzPXunQOBrc3kYMmqw" style="display:block;border-radius: 0;" width="104"/>
                         </a>
                        </td>
                       </tr>
                      </table>
                     </th>
                     <th align="right" class="colsplit" style="font-weight:normal;">
                      <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation">
                       <tr>
                        <td class="w100pc" style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:14px;line-height:20px;color:#fff;margin:0;">
                         <a class="footerlink" data-ua-linkname="bbc_termsofuse_corporatemessaging" style="color:#fff;text-decoration:none;" target="_blank" title="Terms of use">
                          Terms of use
                         </a>
                         <span class="nomob">
                          |
                         </span>
                         <a class="footerlink" data-ua-linkname="bbc_privacyandcookies_corporatemessaging" style="color:#fff;text-decoration:none;" target="_blank" title="Privacy and Cookies">
                          Privacy and Cookies
                         </a>
                         <span class="nomob">
                          |
                         </span>
                         <a class="footerlink" style="color:#fff;text-decoration:none;" target="_blank" title="Click to unsubscribe">
                          Unsubscribe
                         </a>
                        </td>
                       </tr>
                      </table>
                     </th>
                    </tr>
                   </table>
                  </td>
                 </tr>
                </table>
               </td>
              </tr>
             </table>
             <!-- Footer - Logo and links -->
             <!-- Footer terms -->
             <table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%">
              <tr>
               <td align="center" style="background:#fff;">
                <table border="0" cellpadding="0" cellspacing="0" class="wrapto100pc" role="presentation" style="width:720px;" width="720">
                 <tr>
                  <td align="center" style="padding: 16px 10px;">
                   <table border="0" cellpadding="0" cellspacing="0" class="w100pc" role="presentation" style="width:640px;" width="640">
                    <tr>
                     <td>
                      <p class="footertext" style="font-family:'bbcreithsansrg1', Helvetica, Arial, sans-serif;font-size:14px;line-height:20px;color:#1e1e1e;margin:0 70px 0 0;text-align:left;">
                       To stop receiving ‘BBC emails for you’ newsletters
                       <a style="color: #000001; text-decoration:underline" target="_blank" title="Click to unsubscribe">
                        click here to unsubscribe
                       </a>
                       . Or you can
                    update your email preferences in your
                       <a data-ua-linkname="bbc_accountsettings_corporatemessaging" style="color: #000001; text-decoration:underline;" target="_blank" title="">
                        BBC account
                      settings.
                       </a>
                       <br/>
                       <br/>
                       This email is intended for UK residents. Please
                    note that some features and content in this newsletter are only
                    available to people in the UK. You can update your personal details
                    including your Postcode and Email Address in your
                       <a data-ua-linkname="bbc_accountsettings_corporatemessaging" style="color:#000001;text-decoration:underline;" target="_blank" title="">
                        account
                      settings
                       </a>
                       .
                       <br/>
                       <br/>
                       Find out everything you need to know about using
                    your BBC account,
                       <a data-ua-linkname="bbc_accountinfo_corporatemessaging" style="color: #000001; text-decoration:underline" target="_blank" title="">
                        all in one
                      place
                       </a>
                       .
                       <br/>
                       This email newsletter suggests things we think you'll
                    like based on what we know about you. To find out more about
                    personalisation at the BBC,
                       <a data-ua-linkname="bbc_externallinkspersonalisation_corporatemessaging" style="color: #000001; text-decoration:underline" target="_blank" title="">
                        click here
                       </a>
                       .
                       <br/>
                       <br/>
                       The BBC is not
                    responsible for the content of external sites. Read about our
                       <a data-ua-linkname="bbc_externallinkspersonalisation_corporatemessaging" style="color: #000001; text-decoration:underline" target="_blank" title="">
                        approach to external linking
                       </a>
                       .
                       <br/>
                       <br/>
                       Replies to this email will not be monitored. If you have any questions, please refer
                       <a data-ua-linkname="bbc_faq_corporatemessaging" style="color: #000001;
text-decoration:underline" target="_blank" title="to our FAQ page">
                        to our FAQ page
                       </a>
                       .
                       <br/>
                       <br/>
                       BBC Broadcasting House, Portland Place, London W1A 1AA, UK
                       <br/>
                       Copyright
                    © 2025 BBC
                       <a clicktracking="off" data-ua-unsubscribe="https://asemailmgmtus.com/api/channels/email/unsubscribe?app_key=V0Qxw0oTSXem8eOBxv8BSQ&channel_id=ZfDdoRtiQKeCaI0aKxP6Lg&push_id=253bb3b1-2501-11f0-8030-000000a1ace5&message_type=commercial&redirect=https%3A%2F%2Fasemailmgmtus.com%2Funsubscribe%2Fsuccess.html" style="color: #ffffff;" target="_blank" title="">
                        .
                       </a>
                       <br/>
                      </p>
                     </td>
                    </tr>
                   </table>
                  </td>
                 </tr>
                </table>
               </td>
              </tr>
             </table>
             <!-- /Footer terms -->
            </td>
           </tr>
          </tbody>
         </table>
        </td>
       </tr>
      </tbody>
     </table>
     <!--[if true]> </td> </tr> </table>    <![endif]-->
    </div>
   </div>
  </div>
  <img alt="" border="0" height="1" src="https://inboxflows.com/_/image/https%253A%252F%252Fsgclick.email.bbc.co.uk%252Fwf%252Fopen%253Fupn%253Du001.sl3WV6L-2BAAJx73Q3GVtOp7DI9zHSQf7N7LajKGNsAz-2FC3p-2Fu-2BYYCoKwvhzKqvoGWRZuVYgubf2mr6vm4k4SqtXQc3GcjoqFzAyOVS9ssHpAk7jAttlVLMc8MMFs9xn60C41l8m8oiD28PfEfn-2Fvm84RYYViSREr-2BBuP3pteTzDMzAZo1mCpkkTTB3p6dmEFEIw5RazsX0HSWx8woVzkNWrwHOtaX1r2eGsT1FH8op-2BJLffNXBdVFmH5Tg8aTIj4soVTj78LjXQ-2BYLfDiY-2FaPz4217Q58QvfOSrDJJ6RD9mr4WpGg89m6geek5wXPzg7XcHogUVWGk7wHbz2RJHoT0P7vcNkUS4dCeoAkAKhYZpXbns4or69cJXnh6WcZmQQuAE6XQ3zByCwkHm4dO4mX-2ByzO27IyM0p3A-2Fjb2XD1mnSaAFYn4gDWJHDAqVY2vwEpO-2BTyuDW9eAFItSNg91jtlIBRlryucFWWUYM-2FBZHqmAAK2XOdDGSS47qT6-2F9AnrPTNwKGmVrO-2FGoxmBlbYlqjFQaoz6gr8ZJnVstGFuELty8IZVnfjMhuuXnr8GjO0ISPzILKHjePDdiEhRI69QovEvVo0zzJnwoF3RONcYKPy70czjlL-2FzcKOwoCaDFrKhAfzqiC-2FBTxZros1VuCyWk8rxDhdw-2BhKUL7wt8D5e74u0m2PmL7-2BqKNIwf2Y1vgYpTLrA5bv-2BdHHIM8lYhKnH-2FY7ZiM9qc-2BSdIqdL8dLvu1sGPAIHLEfngvRlEj0I0L-2F9TsKrLz16voD6ufg9v7UI-2FNp1NaHPYNH8ghQr8L6sxJmtEn82YLE5hN4nGQ32CMHiEkptu7W2OPb9IALJTVEwcRicBTVhqb1DOVey-2B2mkDXmza2KugxeJaFsvZegFI6LVZ-2BBmjUe9OkY9p2F81W776AgdyAyL7Bt75-2BRMHdCshcVQihEFoIZ6rT2VashPYjNO9wiG-2BxHal-2Fq3uaMEOS4ceeUHT2Wdnbv6ImOYWaBDQfG4PL3LXGlvVfUl9gmo20Bww1-2BTXvy9iwcu7y5lbUaXHTlmL68JG7-2BglD8vqfo6OZ-2FrnBNpN4f-2BEcakQXUxY3CmyU3LPzyvM-2FzHMPvgynDt7oRw-2B-2BhifVRTEWN5C8-2F-2BrSiKR9ZQL-2Bkw1gv2QqpNu-2FxZhB01fY2xZ2oX89btgZNHb87Ay8ZsqJWgNpUR0mTGJ8qXZamsl02Tg9Iz1bc76z50U2h59JHhj9IigueQkMgWKICQ-3D-3D/?inbox_flows_img_sig=eyJwYXRoIjoiaHR0cHMlM0ElMkYlMkZzZ2NsaWNrLmVtYSIsInRpbWUiOjE3NTQyNDEyOTIuMzk0NTk1fQ:1uicIO:MA5-u1Ai2IE-Lx8qaHhHSTzMow9BdcxwEFSi286QJUc" style="height:1px !important;width:1px !important;border-width:0 !important;margin-top:0 !important;margin-bottom:0 !important;margin-right:0 !important;margin-left:0 !important;padding-top:0 !important;padding-bottom:0 !important;padding-right:0 !important;padding-left:0 !important;" width="1"/>
 </body>
</html>
            
        3 months ago - bbc@email.bbc.co.uk
    
    Plus, detective dramas with Sarah Lancashire and Idris Elba. ͏ ͏ ͏ ͏ ͏ ͏ ͏ ͏ ͏ ͏ ͏ ͏ ͏ ͏ ͏ ͏ ͏ ͏ ...